Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
Protein N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III [82444] (1 species) |
Species Escherichia coli [TaxId:562] [82445] (2 PDB entries) |
Domain d1j53a_: 1j53 A: [77076] complexed with edo, mn, tmp |
PDB Entry: 1j53 (more details), 1.8 Å
SCOPe Domain Sequences for d1j53a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j53a_ c.55.3.5 (A:) N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III {Escherichia coli [TaxId: 562]} rqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdpeafgvh giadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipktntfck vtdslavarkmfpgkrnsldalcaryeidnskrtlhgalldaqilaevylamtg
Timeline for d1j53a_: