Lineage for d1j53a_ (1j53 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886484Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2886828Protein N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III [82444] (1 species)
  7. 2886829Species Escherichia coli [TaxId:562] [82445] (2 PDB entries)
  8. 2886831Domain d1j53a_: 1j53 A: [77076]
    complexed with edo, mn, tmp

Details for d1j53a_

PDB Entry: 1j53 (more details), 1.8 Å

PDB Description: Structure of the N-terminal Exonuclease Domain of the Epsilon Subunit of E.coli DNA Polymerase III at pH 8.5
PDB Compounds: (A:) DNA polymerase III, epsilon chain

SCOPe Domain Sequences for d1j53a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j53a_ c.55.3.5 (A:) N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III {Escherichia coli [TaxId: 562]}
rqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdpeafgvh
giadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipktntfck
vtdslavarkmfpgkrnsldalcaryeidnskrtlhgalldaqilaevylamtg

SCOPe Domain Coordinates for d1j53a_:

Click to download the PDB-style file with coordinates for d1j53a_.
(The format of our PDB-style files is described here.)

Timeline for d1j53a_: