Lineage for d1j3xa_ (1j3x A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987159Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 1987160Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 1987161Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 1987174Protein High mobility group protein 2, HMG2 [109762] (1 species)
  7. 1987175Species Pig (Sus scrofa) [TaxId:9823] [109763] (3 PDB entries)
    Uniprot P17741 1-77, 89-163
  8. 1987177Domain d1j3xa_: 1j3x A: [103840]
    domain A

Details for d1j3xa_

PDB Entry: 1j3x (more details)

PDB Description: solution structure of the n-terminal domain of the hmgb2
PDB Compounds: (A:) High mobility group protein 2

SCOPe Domain Sequences for d1j3xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3xa_ a.21.1.1 (A:) High mobility group protein 2, HMG2 {Pig (Sus scrofa) [TaxId: 9823]}
mgkgdpnkprgkmssyaffvqtsreehkkkhpdssvnfaefskkcserwktmsakekskf
edmaksdkarydremkn

SCOPe Domain Coordinates for d1j3xa_:

Click to download the PDB-style file with coordinates for d1j3xa_.
(The format of our PDB-style files is described here.)

Timeline for d1j3xa_: