Lineage for d1j3pa_ (1j3p A:)
- Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topology
Superfamily b.82.1: RmlC-like cupins [51182] (20 families) 
Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (1 protein) Protein Glucose-6-phosphate isomerase, GPI [89404] (2 species)
Type II phosphoglucose isomerase
Species Archaeon Thermococcus litoralis [TaxId:2265] [101975] (7 PDB entries) 
Domain d1j3pa_: 1j3p A: [90819]
Details for d1j3pa_
PDB Entry: 1j3p (more details), 2.02 Å
PDB Description: crystal structure of thermococcus litoralis phosphoglucose isomerase
PDB Compounds: (A:) phosphoglucose isomeraseSCOP Domain Sequences for d1j3pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j3pa_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Thermococcus litoralis [TaxId: 2265]}
mkykepfgvkldfetgiienakksvrrlsdmkgyfideeawkkmveegdpvvyevyaieq
eekegdlnfattvlypgkvgneffmtkghyhskidraevyfalkgkggmllqtpegearf
iemepgtivyvppywahrtintgdkpfiflalypadaghdygtiaekgfskivveengkv
vvkdnpk
SCOP Domain Coordinates for d1j3pa_:
Click to download the PDB-style file with coordinates for d1j3pa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j3pa_:
- d1j3pa_ first appeared in SCOP 1.67
- d1j3pa_ appears in SCOP 1.71
- d1j3pa_ appears in SCOP 1.75
- d1j3pa_ appears in the current release, SCOPe 2.08
View in 3D
