Lineage for d1j3ba2 (1j3b A:2-211)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 848369Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 848370Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (1 family) (S)
  5. 848371Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (2 proteins)
  6. 848382Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68925] (3 species)
  7. 848394Species Thermus thermophilus [TaxId:274] [82555] (3 PDB entries)
    Uniprot Q7SIC6
  8. 848395Domain d1j3ba2: 1j3b A:2-211 [77072]
    Other proteins in same PDB: d1j3ba1, d1j3bb1

Details for d1j3ba2

PDB Entry: 1j3b (more details), 2 Å

PDB Description: Crystal structure of ATP-dependent phosphoenolpyruvate carboxykinase from Thermus thermophilus HB8
PDB Compounds: (A:) ATP-dependent phosphoenolpyruvate carboxykinase

SCOP Domain Sequences for d1j3ba2:

Sequence, based on SEQRES records: (download)

>d1j3ba2 c.109.1.1 (A:2-211) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]}
qrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvvr
epevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvte
spwhalfarnmfilprrfgnddeveafvpgftvvhapyfqavperdgtrsevfvgisfqr
rlvlivgtkyageikksiftvmnylmpkrg

Sequence, based on observed residues (ATOM records): (download)

>d1j3ba2 c.109.1.1 (A:2-211) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]}
qrlealgihpkkrvfwntvspvlvehtllrgegllahhgplvvdttpytgrspkdkfvvr
epevegeiwwgevnqpfapeafealyqrvvqylserdlyvqdlyagadrryrlavrvvte
spwhalfarnmfilprrfgafvpgftvvhapyfqavperdgtrsevfvgisfqrrlvliv
gtkyageikksiftvmnylmpkrg

SCOP Domain Coordinates for d1j3ba2:

Click to download the PDB-style file with coordinates for d1j3ba2.
(The format of our PDB-style files is described here.)

Timeline for d1j3ba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j3ba1