Lineage for d1j2za_ (1j2z A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962569Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 962570Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 962571Family b.81.1.1: UDP N-acetylglucosamine acyltransferase [51162] (1 protein)
    this is a repeat family; one repeat unit is 2jf2 A:59-89 found in domain
  6. 962572Protein UDP N-acetylglucosamine acyltransferase [51163] (2 species)
  7. 962580Species Helicobacter pylori [TaxId:210] [101964] (1 PDB entry)
  8. 962581Domain d1j2za_: 1j2z A: [90805]
    complexed with so4, sog, tla

Details for d1j2za_

PDB Entry: 1j2z (more details), 2.1 Å

PDB Description: crystal structure of udp-n-acetylglucosamine acyltransferase
PDB Compounds: (A:) acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase

SCOPe Domain Sequences for d1j2za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]}
skiaktaiispkaeinkgveigefcvigdgvkldegvklhnnvtlqghtfvgknteifpf
avlgtqpqdlkykgeyseliigednlirefcminpgteggikktligdknllmayvhvah
dcvigshcilangvtlaghieigdyvniggltaihqfvriakgcmiagksalgkdvppyc
tvegnrafirglnrhrmrqlleskdidfiyalykrlfrpipslresakleleehannpfv
keicsfilessrgvaykss

SCOPe Domain Coordinates for d1j2za_:

Click to download the PDB-style file with coordinates for d1j2za_.
(The format of our PDB-style files is described here.)

Timeline for d1j2za_: