Lineage for d1j2ga2 (1j2g A:159-312)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
    automatically mapped to Pfam PF01014
  6. Protein Urate oxidase (uricase) [55634] (3 species)
    duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16
  7. Species Bacillus sp., strain TB-90 [TaxId:1409] [111089] (1 PDB entry)
    Uniprot Q45697 177-482
  8. Domain d1j2ga2: 1j2g A:159-312 [103825]
    complexed with aza, so4

Details for d1j2ga2

PDB Entry: 1j2g (more details), 2.2 Å

PDB Description: Crystal structure of Urate oxidase from Bacillus SP. TB-90 co-crystallized with 8-Azaxanthine
PDB Compounds: (A:) Uricase

SCOPe Domain Sequences for d1j2ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2ga2 d.96.1.4 (A:159-312) Urate oxidase (uricase) {Bacillus sp., strain TB-90 [TaxId: 1409]}
dntlniteqqsglaglqlikvsgnsfvgfirdeyttlpedsnrplfvylnikwkyknted
sfgtnpenyvaaeqirdiatsvfhetetlsiqhliyligrrilerfpqlqevyfesqnht
wdkiveeipesegkvyteprppygfqcftvtqed

SCOPe Domain Coordinates for d1j2ga2 are not available.

Timeline for d1j2ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j2ga1
View in 3D
Domains from other chains:
(mouse over for more information)
d1j2gb1, d1j2gb2, d1j2gc1, d1j2gc2, d1j2gd1, d1j2gd2