Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) |
Protein Alginate-binding periplasmic protein AlgQ2 [69624] (1 species) |
Species Sphingomonas sp. [TaxId:28214] [69625] (2 PDB entries) |
Domain d1j1na_: 1j1n A: [83978] complexed with ca |
PDB Entry: 1j1n (more details), 1.6 Å
SCOPe Domain Sequences for d1j1na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j1na_ c.94.1.1 (A:) Alginate-binding periplasmic protein AlgQ2 {Sphingomonas sp. [TaxId: 28214]} keatwvtdkpltlkihmhfrdkwvwdenwpvakesfrltnvklqsvankaatnsqeqfnl mmasgdlpdvvggdnlkdkfiqygqegafvplnklidqyaphikaffkshpeveraikap dgniyfipyvpdgvvargyfiredwlkklnlkppqnidelytvlkafkekdpngngkade vpfidrhpdevfrlvnfwgarssgsdnymdfyidngrvkhpwaetafrdgmkhvaqwyke glidkeiftrkakareqmfggnlggfthdwfastmtfneglaktvpgfklipiapptnsk gqrweedsrqkvrpdgwaitvknknpvetikffdfyfsrpgrdisnfgvpgvtydikngk avfkdsvlkspqpvnnqlydmgaqipigfwqdydyerqwttpeaqagidmyvkgkyvmpg fegvnmtreeraiydkywadvrtymyemgqawvmgtkdvdktwdeyqrqlklrglyqvlq mmqqaydrqykn
Timeline for d1j1na_: