Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.14: SH3BGR (SH3-binding, glutamic acid-rich protein-like) [102446] (2 proteins) related to glutaredoxin 1 (GRX1) but lacks both conserved cysteine residues automatically mapped to Pfam PF04908 |
Protein SH3BGRL3 [102447] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [102448] (2 PDB entries) Uniprot Q91VW3 |
Domain d1j0fa_: 1j0f A: [90739] |
PDB Entry: 1j0f (more details)
SCOPe Domain Sequences for d1j0fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j0fa_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} gsegaatmsglrvystsvtgsreiksqqsevtrildgkriqyqlvdisqdnalrdemrtl agnpkatppqivngnhycgdyelfveaveqdtlqeflkla
Timeline for d1j0fa_: