Lineage for d1j09a2 (1j09 A:1-305)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) 
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
contains a conserved all-alpha subdomain at the C-terminal extension
Protein Glutamyl-tRNA synthetase (GluRS) [52382] (1 species)
Catalytic domain is very similar to that of GlnRSSpecies Thermus thermophilus [TaxId:274] [52383] (11 PDB entries) 
Domain d1j09a2: 1j09 A:1-305 [77026]
Other proteins in same PDB: d1j09a1
protein/RNA complex; complexed with atp, glu, mg
Details for d1j09a2
PDB Entry: 1j09 (more details), 1.8 Å
PDB Description: Crystal structure of Thermus thermophilus glutamyl-tRNA synthetase complexed with ATP and Glu
PDB Compounds: (A:) Glutamyl-tRNA synthetaseSCOPe Domain Sequences for d1j09a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j09a2 c.26.1.1 (A:1-305) Glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]}
mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaal
kwlglsydegpdvggphgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekg
gydgrarnippeeaeerarrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllk
sdgyptyhlanvvddhlmgvtdviraeewlvstpihvllyrafgweaprfyhmpllrnpd
ktkiskrkshtsldwykaegflpealrnylclmgfsmpdgreiftleefiqaftwervsl
ggpvf
SCOPe Domain Coordinates for d1j09a2:
Click to download the PDB-style file with coordinates for d1j09a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j09a2:
- d1j09a2 first appeared in SCOP 1.63
- d1j09a2 appears in SCOPe 2.06
- d1j09a2 appears in the current release, SCOPe 2.08
View in 3D
