![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (23 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
![]() | Protein Maltogenic amylase, N-terminal domain N [49221] (4 species) precedes the catalytic (beta/alpha)8-barrel domain |
![]() | Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [74843] (9 PDB entries) |
![]() | Domain d1izja1: 1izj A:1-122 [83841] Other proteins in same PDB: d1izja2, d1izja3 complexed with ca; mutant |
PDB Entry: 1izj (more details), 2.2 Å
SCOP Domain Sequences for d1izja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1izja1 b.1.18.2 (A:1-122) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} aandnnvewnglfhdqgplfdnapeptstqsvtlklrtfkgditsanikywdtadnafhw vpmvwdsndptgtfdywkgtipaspsikyyrfqindgtstawyngngpsstepnaddfyi ip
Timeline for d1izja1: