Lineage for d1izja1 (1izj A:1-122)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789056Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 789222Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
    precedes the catalytic (beta/alpha)8-barrel domain
  7. 789226Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [74843] (9 PDB entries)
  8. 789233Domain d1izja1: 1izj A:1-122 [83841]
    Other proteins in same PDB: d1izja2, d1izja3
    complexed with ca; mutant

Details for d1izja1

PDB Entry: 1izj (more details), 2.2 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase 1 mutant enzyme f313a
PDB Compounds: (A:) amylase

SCOP Domain Sequences for d1izja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1izja1 b.1.18.2 (A:1-122) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]}
aandnnvewnglfhdqgplfdnapeptstqsvtlklrtfkgditsanikywdtadnafhw
vpmvwdsndptgtfdywkgtipaspsikyyrfqindgtstawyngngpsstepnaddfyi
ip

SCOP Domain Coordinates for d1izja1:

Click to download the PDB-style file with coordinates for d1izja1.
(The format of our PDB-style files is described here.)

Timeline for d1izja1: