Lineage for d1iz5a1 (1iz5 A:2-120)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976821Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2976822Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2977007Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2977029Protein Proliferating cell nuclear antigen (PCNA) [55989] (8 species)
  7. 2977154Species Pyrococcus furiosus [TaxId:2261] [55992] (5 PDB entries)
  8. 2977155Domain d1iz5a1: 1iz5 A:2-120 [83834]
    mutant

Details for d1iz5a1

PDB Entry: 1iz5 (more details), 1.8 Å

PDB Description: pyrococcus furiosus pcna mutant (met73leu, asp143ala, asp147ala): orthorhombic form
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d1iz5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iz5a1 d.131.1.2 (A:2-120) Proliferating cell nuclear antigen (PCNA) {Pyrococcus furiosus [TaxId: 2261]}
pfeivfegakefaqlidtasklideaafkvtedgismramdpsrvvlidlnlpssifsky
evvepetigvnldhlkkilkrgkakdtlilkkgeenfleitiqgtatrtfrvplidvee

SCOPe Domain Coordinates for d1iz5a1:

Click to download the PDB-style file with coordinates for d1iz5a1.
(The format of our PDB-style files is described here.)

Timeline for d1iz5a1:

2977155
d1iz5a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1iz5a2