Lineage for d1iz4a2 (1iz4 A:126-247)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.131: DNA clamp [55978] (1 superfamily)
contains two helices and two beta sheets
duplication: fold has internal pseudo two-fold symmetrySuperfamily d.131.1: DNA clamp [55979] (3 families) 
Family d.131.1.2: DNA polymerase processivity factor [55983] (5 proteins)
duplication: consists of two domains of this foldProtein Proliferating cell nuclear antigen (PCNA) [55989] (8 species) 
Species Pyrococcus furiosus [TaxId:2261] [55992] (5 PDB entries) 
Domain d1iz4a2: 1iz4 A:126-247 [83833]
mutant
Details for d1iz4a2
PDB Entry: 1iz4 (more details), 2 Å
PDB Description: pyrococcus furiosus pcna mutant (met73leu/asp143ala): tetragonal form
PDB Compounds: (A:) Proliferating Cell Nuclear AntigenSCOPe Domain Sequences for d1iz4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iz4a2 d.131.1.2 (A:126-247) Proliferating cell nuclear antigen (PCNA) {Pyrococcus furiosus [TaxId: 2261]}
pelpftakvvvlgevlkaavkdaslvsdsikfiarenefimkaegetqeveikltledeg
lldievqeetksaygvsylsdmvkglgkadevtikfgnempmqmeyyirdegrltfllap
rv
SCOPe Domain Coordinates for d1iz4a2:
Click to download the PDB-style file with coordinates for d1iz4a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iz4a2:
- d1iz4a2 first appeared in SCOP 1.65
- d1iz4a2 appears in SCOPe 2.06
- d1iz4a2 appears in the current release, SCOPe 2.08
View in 3D
