Lineage for d1iyxa2 (1iyx A:1-136)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947583Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2947634Protein Enolase [54828] (10 species)
  7. 2947663Species Enterococcus hirae [TaxId:1354] [89926] (1 PDB entry)
  8. 2947664Domain d1iyxa2: 1iyx A:1-136 [83816]
    Other proteins in same PDB: d1iyxa1, d1iyxb1
    complexed with gol, mg, so4

Details for d1iyxa2

PDB Entry: 1iyx (more details), 2.8 Å

PDB Description: Crystal structure of enolase from Enterococcus hirae
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d1iyxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyxa2 d.54.1.1 (A:1-136) Enolase {Enterococcus hirae [TaxId: 1354]}
siitdvyareildsrgnptievevytesgafgrgmvpsgastgeyeavelrdgdkarygg
kgvtkavdnvnniiaeaiigydvrdqmaidkamialdgtpnkgklganailgvsiavara
aadylevplyhylggf

SCOPe Domain Coordinates for d1iyxa2:

Click to download the PDB-style file with coordinates for d1iyxa2.
(The format of our PDB-style files is described here.)

Timeline for d1iyxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iyxa1