Lineage for d1iyqa_ (1iyq A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244418Protein beta-Lactamase, class A [56606] (16 species)
  7. 2244557Species Escherichia coli, TOHO-1 [TaxId:562] [56608] (26 PDB entries)
  8. 2244578Domain d1iyqa_: 1iyq A: [76972]
    complexed with pnm, so4

Details for d1iyqa_

PDB Entry: 1iyq (more details), 2.1 Å

PDB Description: toho-1 beta-lactamase in complex with benzylpenicillin
PDB Compounds: (A:) Toho-1 beta-lactamase

SCOPe Domain Sequences for d1iyqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyqa_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TOHO-1 [TaxId: 562]}
nsvqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesd
khllnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdk
vtafarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraql
vtwlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpe
qkaerrrdilaaaakivthgf

SCOPe Domain Coordinates for d1iyqa_:

Click to download the PDB-style file with coordinates for d1iyqa_.
(The format of our PDB-style files is described here.)

Timeline for d1iyqa_: