Lineage for d1ixmb_ (1ixm B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974226Fold d.123: Sporulation response regulatory protein Spo0B [55889] (1 superfamily)
    core: alpha-beta-alpha-beta(2)-(alpha)-beta(2)
  4. 2974227Superfamily d.123.1: Sporulation response regulatory protein Spo0B [55890] (1 family) (S)
    Histidine kinase-like fold lacking the kinase ATP-binding site
  5. 2974228Family d.123.1.1: Sporulation response regulatory protein Spo0B [55891] (1 protein)
  6. 2974229Protein Sporulation response regulatory protein Spo0B [55892] (1 species)
  7. 2974230Species Bacillus subtilis [TaxId:1423] [55893] (3 PDB entries)
  8. 2974232Domain d1ixmb_: 1ixm B: [41115]

Details for d1ixmb_

PDB Entry: 1ixm (more details), 2.6 Å

PDB Description: crystal structure of spoob from bacillus subtilis
PDB Compounds: (B:) protein (sporulation response regulatory protein)

SCOPe Domain Sequences for d1ixmb_:

Sequence, based on SEQRES records: (download)

>d1ixmb_ d.123.1.1 (B:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]}
nisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsn
lktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsrese
nhltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieig
ld

Sequence, based on observed residues (ATOM records): (download)

>d1ixmb_ d.123.1.1 (B:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]}
nisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsn
lktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsrese
nhltvslqtdhpdrqlilyldfhgafadpsafddivdimrfeitsheclieigld

SCOPe Domain Coordinates for d1ixmb_:

Click to download the PDB-style file with coordinates for d1ixmb_.
(The format of our PDB-style files is described here.)

Timeline for d1ixmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ixma_