Lineage for d1ixba2 (1ixb A:91-205)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946003Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2946129Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)
  7. 2946154Species Escherichia coli [TaxId:562] [54722] (12 PDB entries)
  8. 2946157Domain d1ixba2: 1ixb A:91-205 [76904]
    Other proteins in same PDB: d1ixba1, d1ixbb1
    complexed with mh2; mutant

Details for d1ixba2

PDB Entry: 1ixb (more details), 0.9 Å

PDB Description: crystal structure of the e. coli manganese(ii) superoxide dismutase mutant y174f at 0.90 angstroms resolution.
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d1ixba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixba2 d.44.1.1 (A:91-205) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
gttlqgdlkaaierdfgsvdnfkaefekaaasrfgsgwawlvlkgdklavvstanqdspl
mgeaisgasgfpimgldvwehayflkfqnrrpdyikefwnvvnwdeaaarfaakk

SCOPe Domain Coordinates for d1ixba2:

Click to download the PDB-style file with coordinates for d1ixba2.
(The format of our PDB-style files is described here.)

Timeline for d1ixba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ixba1