Lineage for d1ixba1 (1ixb A:1-90)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1256372Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1256627Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1256628Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 1256758Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)
  7. 1256778Species Escherichia coli [TaxId:562] [46620] (12 PDB entries)
  8. 1256781Domain d1ixba1: 1ixb A:1-90 [76903]
    Other proteins in same PDB: d1ixba2, d1ixbb2
    complexed with mh2; mutant

Details for d1ixba1

PDB Entry: 1ixb (more details), 0.9 Å

PDB Description: crystal structure of the e. coli manganese(ii) superoxide dismutase mutant y174f at 0.90 angstroms resolution.
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d1ixba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixba1 a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
dqlpadkktvlrnnagghanhslfwkglkk

SCOPe Domain Coordinates for d1ixba1:

Click to download the PDB-style file with coordinates for d1ixba1.
(The format of our PDB-style files is described here.)

Timeline for d1ixba1:

1256781
d1ixba1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1ixba2