Class a: All alpha proteins [46456] (284 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
Protein Mn superoxide dismutase (MnSOD) [46618] (9 species) |
Species Escherichia coli [TaxId:562] [46620] (12 PDB entries) |
Domain d1ixba1: 1ixb A:1-90 [76903] Other proteins in same PDB: d1ixba2, d1ixbb2 complexed with mh2; mutant |
PDB Entry: 1ixb (more details), 0.9 Å
SCOPe Domain Sequences for d1ixba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixba1 a.2.11.1 (A:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl dqlpadkktvlrnnagghanhslfwkglkk
Timeline for d1ixba1: