Lineage for d1ix3a_ (1ix3 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1749970Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 1749971Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 1749972Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. 1750018Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 1750074Species Norway rat (Rattus norvegicus) [TaxId:10116] [48617] (25 PDB entries)
    Uniprot P06762 11-222
  8. 1750090Domain d1ix3a_: 1ix3 A: [90714]
    complexed with cyn, hem

Details for d1ix3a_

PDB Entry: 1ix3 (more details), 2 Å

PDB Description: Crystal Structure of Rat Heme Oxygenase-1 in complex with Heme bound to Cyanide
PDB Compounds: (A:) heme oxygenase-1

SCOPe Domain Sequences for d1ix3a_:

Sequence, based on SEQRES records: (download)

>d1ix3a_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeiernkq
npvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthpellv
ahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarmntle
mtpevkhrvteeaktafllnielfeelqallteehkdqspsqteflrqrpasl

Sequence, based on observed residues (ATOM records): (download)

>d1ix3a_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qdlsealkeatkevhiraensefmrnfqkgqvsregfklvmaslyhiytaleeeiernkq
npvyaplyfpeelhrraaleqdmafwygphwqeaipytpatqhyvkrlhevggthpellv
ahaytrylgdlsggqvlkkiaqkamalpssgeglafftfpsidnptkfkqlyrarmntle
mtpevkhrvteeaktafllnielfeelqallteflrqrpasl

SCOPe Domain Coordinates for d1ix3a_:

Click to download the PDB-style file with coordinates for d1ix3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ix3a_: