![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.7: Meta-cation ATPase, catalytic domain P [81656] (2 proteins) interrupted by a large insertion, domain N |
![]() | Protein Calcium ATPase, catalytic domain P [81655] (1 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81654] (37 PDB entries) Uniprot P04191 |
![]() | Domain d1iwoa2: 1iwo A:344-360,A:600-750 [75855] Other proteins in same PDB: d1iwoa1, d1iwoa3, d1iwoa4, d1iwob1, d1iwob3, d1iwob4 Structure in the absence of calcium ions complexed with tg1 |
PDB Entry: 1iwo (more details), 3.1 Å
SCOPe Domain Sequences for d1iwoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iwoa2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} ctsvicsdktgtlttnqXldpprkevmgsiqlcrdagirvimitgdnkgtaiaicrrigi fgeneevadraytgrefddlplaeqreacrraccfarvepshkskiveylqsydeitamt gdgvndapalkkaeigiamgsgtavaktasemvladdnfstivaaveeg
Timeline for d1iwoa2:
![]() Domains from other chains: (mouse over for more information) d1iwob1, d1iwob2, d1iwob3, d1iwob4 |