Lineage for d1iw7f1 (1iw7 F:258-318)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 907774Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 907775Family a.4.13.1: Sigma3 domain [88660] (3 proteins)
  6. 907787Protein Sigma70 [88661] (1 species)
  7. 907788Species Thermus thermophilus [TaxId:274] [88662] (9 PDB entries)
    Uniprot Q9WX78
  8. 907799Domain d1iw7f1: 1iw7 F:258-318 [83086]
    Other proteins in same PDB: d1iw7a1, d1iw7a2, d1iw7b1, d1iw7b2, d1iw7c_, d1iw7d_, d1iw7e_, d1iw7f2, d1iw7f3, d1iw7k1, d1iw7k2, d1iw7l1, d1iw7l2, d1iw7m_, d1iw7n_, d1iw7o_, d1iw7p2, d1iw7p3
    complexed with mg, pb

Details for d1iw7f1

PDB Entry: 1iw7 (more details), 2.6 Å

PDB Description: Crystal structure of the RNA polymerase holoenzyme from Thermus thermophilus at 2.6A resolution
PDB Compounds: (F:) RNA polymerase sigma-70 subunit

SCOPe Domain Sequences for d1iw7f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iw7f1 a.4.13.1 (F:258-318) Sigma70 {Thermus thermophilus [TaxId: 274]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e

SCOPe Domain Coordinates for d1iw7f1:

Click to download the PDB-style file with coordinates for d1iw7f1.
(The format of our PDB-style files is described here.)

Timeline for d1iw7f1: