Lineage for d1iw1a_ (1iw1 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1282621Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 1282622Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 1282623Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. 1282627Protein Heme oxygenase HmuO [89159] (1 species)
  7. 1282628Species Corynebacterium diphtheriae [TaxId:1717] [89160] (16 PDB entries)
    Uniprot P71119
  8. 1282634Domain d1iw1a_: 1iw1 A: [83723]
    complexed with hem, so4, suc

Details for d1iw1a_

PDB Entry: 1iw1 (more details), 1.5 Å

PDB Description: crystal structure of a heme oxygenase (hmuo) from corynebacterium diphtheriae complexed with heme in the ferrous state
PDB Compounds: (A:) Heme oxygenase

SCOPe Domain Sequences for d1iw1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iw1a_ a.132.1.1 (A:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
ttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavd
avrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvd
gpalvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekln
nlelsdeqrehllkeatdafvfnhqvfadlgk

SCOPe Domain Coordinates for d1iw1a_:

Click to download the PDB-style file with coordinates for d1iw1a_.
(The format of our PDB-style files is described here.)

Timeline for d1iw1a_: