Lineage for d1ivta_ (1ivt A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764999Superfamily b.1.16: Lamin A/C globular tail domain [74853] (2 families) (S)
  5. 2765000Family b.1.16.1: Lamin A/C globular tail domain [74854] (2 proteins)
    automatically mapped to Pfam PF00932
  6. 2765001Protein Lamin A/C globular tail domain [74855] (2 species)
  7. 2765002Species Human (Homo sapiens) [TaxId:9606] [74856] (2 PDB entries)
  8. 2765004Domain d1ivta_: 1ivt A: [71443]

Details for d1ivta_

PDB Entry: 1ivt (more details)

PDB Description: nmr structures of the c-terminal globular domain of human lamin a/c
PDB Compounds: (A:) Lamin A/C

SCOPe Domain Sequences for d1ivta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivta_ b.1.16.1 (A:) Lamin A/C globular tail domain {Human (Homo sapiens) [TaxId: 9606]}
ssfsqhartsgrvaveevdeegkfvrlrnksnedqsmgnwqikrqngddplltyrfppkf
tlkagqvvtiwaagagathspptdlvwkaqntwgcgnslrtalinstgeevamrklvrsv
tv

SCOPe Domain Coordinates for d1ivta_:

Click to download the PDB-style file with coordinates for d1ivta_.
(The format of our PDB-style files is described here.)

Timeline for d1ivta_: