Lineage for d1iujb_ (1iuj B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) 
dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
Family d.58.4.5: PG130-like [102959] (6 proteins)
subfamily of Pfam PF03992
Protein Hypothetical protein TT1380 [102960] (1 species) Species Thermus thermophilus [TaxId:274] [102961] (1 PDB entry) 
Domain d1iujb_: 1iuj B: [90702]
structural genomics
complexed with zn
Details for d1iujb_
PDB Entry: 1iuj (more details), 1.6 Å
PDB Description: The structure of TT1380 protein from thermus thermophilus
PDB Compounds: (B:) hypothetical protein TT1380SCOPe Domain Sequences for d1iujb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iujb_ d.58.4.5 (B:) Hypothetical protein TT1380 {Thermus thermophilus [TaxId: 274]}
mfvtmnripvrpeyaeqfeeafrqrarlvdrmpgfirnlvlrpknpgdpyvvmtlwesee
afrawtespafkegharsgtlpkeaflgpnrleafevvldseg
SCOPe Domain Coordinates for d1iujb_:
Click to download the PDB-style file with coordinates for d1iujb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iujb_:
- d1iujb_ first appeared in SCOP 1.67
- d1iujb_ appears in SCOPe 2.04
- d1iujb_ appears in SCOPe 2.06
- d1iujb_ appears in the current release, SCOPe 2.08
View in 3D
