Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.61: LigT-like [55143] (1 superfamily) duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III |
Superfamily d.61.1: LigT-like [55144] (5 families) |
Family d.61.1.2: 2'-5' RNA ligase LigT [89967] (1 protein) |
Protein 2'-5' RNA ligase LigT [89968] (1 species) |
Species Thermus thermophilus [TaxId:274] [89969] (1 PDB entry) TT0787 |
Domain d1iuha_: 1iuh A: [83711] structural genomics |
PDB Entry: 1iuh (more details), 2.5 Å
SCOPe Domain Sequences for d1iuha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iuha_ d.61.1.2 (A:) 2'-5' RNA ligase LigT {Thermus thermophilus [TaxId: 274]} mrlfyavflpeevraalveaqtkvrpfrgwkpvpphqlhltllflgerpeeelpdylalg hrlarleapfrarlrgtgyfpnegtprvwfakaeaegflrlaeglragveellgeeavri pgwdkpfkphitlarrkapaprvppvlfglewpvegfalvrselkpkgpvytvlekfslr geh
Timeline for d1iuha_: