Lineage for d1iuha_ (1iuh A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1912229Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 1912230Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. 1912240Family d.61.1.2: 2'-5' RNA ligase LigT [89967] (1 protein)
  6. 1912241Protein 2'-5' RNA ligase LigT [89968] (1 species)
  7. 1912242Species Thermus thermophilus [TaxId:274] [89969] (1 PDB entry)
    TT0787
  8. 1912243Domain d1iuha_: 1iuh A: [83711]
    structural genomics

Details for d1iuha_

PDB Entry: 1iuh (more details), 2.5 Å

PDB Description: crystal structure of tt0787 of thermus thermophilus hb8
PDB Compounds: (A:) 2'-5' RNA Ligase

SCOPe Domain Sequences for d1iuha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iuha_ d.61.1.2 (A:) 2'-5' RNA ligase LigT {Thermus thermophilus [TaxId: 274]}
mrlfyavflpeevraalveaqtkvrpfrgwkpvpphqlhltllflgerpeeelpdylalg
hrlarleapfrarlrgtgyfpnegtprvwfakaeaegflrlaeglragveellgeeavri
pgwdkpfkphitlarrkapaprvppvlfglewpvegfalvrselkpkgpvytvlekfslr
geh

SCOPe Domain Coordinates for d1iuha_:

Click to download the PDB-style file with coordinates for d1iuha_.
(The format of our PDB-style files is described here.)

Timeline for d1iuha_: