Lineage for d1isfa_ (1isf A:)
- Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) 
there are similar active site architectures as well as the catalytic mechanisms of functionally characterised membersFamily c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
contains extra N-terminal all-alpha subdomain
Protein Bone marror stromal cell antigen 1, BST-1/CD157 (ADP ribosyl cyclase-2) [75597] (1 species) Species Human (Homo sapiens) [TaxId:9606] [75598] (6 PDB entries) 
Domain d1isfa_: 1isf A: [71388]
complexed with gol
Details for d1isfa_
PDB Entry: 1isf (more details), 2.5 Å
PDB Description: crystal structure analysis of bst-1/cd157
PDB Compounds: (A:) bone marrow stromal cell antigen 1SCOPe Domain Sequences for d1isfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1isfa_ c.23.14.3 (A:) Bone marror stromal cell antigen 1, BST-1/CD157 (ADP ribosyl cyclase-2) {Human (Homo sapiens) [TaxId: 9606]}
wraegtsahlrdiflgrcaeyrallspeqrnkdctaiweafkvaldkdpcsvlpsdydlf
itlsrhsiprdkslfwenshllvnsfadntrrfmplsdvlygrvadflswcrqkadsgld
yqscptsedcennpvdsfwkrasiqyskdssgvihvmlngseptgaypikgffadyeipn
lqkekitrieiwvmheiggpnvescgegsmkvlekrlkdmgfqyscindyrpvkllqcvd
hsthpdcalk
SCOPe Domain Coordinates for d1isfa_:
Click to download the PDB-style file with coordinates for d1isfa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1isfa_:
- d1isfa_ first appeared in SCOP 1.61
- d1isfa_ appears in SCOP 1.75
- d1isfa_ appears in SCOPe 2.02
- d1isfa_ appears in the current release, SCOPe 2.08
View in 3D
