Lineage for d1is3a_ (1is3 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. Protein Congerin II [82034] (1 species)
  7. Species Conger eel (Conger myriaster) [TaxId:7943] [82035] (4 PDB entries)
  8. Domain d1is3a_: 1is3 A: [76773]
    complexed with mes

Details for d1is3a_

PDB Entry: 1is3 (more details), 1.45 Å

PDB Description: lactose and mes-liganded congerin ii
PDB Compounds: (A:) Congerin II

SCOPe Domain Sequences for d1is3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1is3a_ b.29.1.3 (A:) Congerin II {Conger eel (Conger myriaster) [TaxId: 7943]}
draevrnipfklgmyltvggvvnsnatrfsinvgestdsiamhmdhrfsygadqnvlvln
slvhnvgwqqeerskkfpftkgdhfqttitfdthtfyiqlsngetvefpnrnkdaafnli
ylagdarltfvrle

SCOPe Domain Coordinates for d1is3a_ are not available.

Timeline for d1is3a_: