Lineage for d1irza_ (1irz A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305994Family a.4.1.11: GARP response regulators [81683] (1 protein)
    plant myb-related DNA-binding motif
    automatically mapped to Pfam PF00249
  6. 2305995Protein Arr10-B [81684] (1 species)
  7. 2305996Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [81685] (1 PDB entry)
  8. 2305997Domain d1irza_: 1irz A: [76772]

Details for d1irza_

PDB Entry: 1irz (more details)

PDB Description: solution structure of arr10-b belonging to the garp family of plant myb-related dna binding motifs of the arabidopsis response regulators
PDB Compounds: (A:) arr10-b

SCOPe Domain Sequences for d1irza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
taqkkprvlwthelhnkflaavdhlgveravpkkildlmnvdkltrenvashlqkfrval
kkvs

SCOPe Domain Coordinates for d1irza_:

Click to download the PDB-style file with coordinates for d1irza_.
(The format of our PDB-style files is described here.)

Timeline for d1irza_: