Lineage for d1irqb_ (1irq B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 915404Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 915405Superfamily a.43.1: Ribbon-helix-helix [47598] (11 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 915503Family a.43.1.4: Omega transcriptional repressor [100971] (2 proteins)
    plasmid-encoded, similar to the phage repressor family
  6. 915504Protein Omega transcriptional repressor [69031] (1 species)
  7. 915505Species Streptococcus pyogenes [TaxId:1314] [69032] (1 PDB entry)
  8. 915507Domain d1irqb_: 1irq B: [66298]

Details for d1irqb_

PDB Entry: 1irq (more details), 1.5 Å

PDB Description: Crystal structure of omega transcriptional repressor at 1.5A resolution
PDB Compounds: (B:) omega transcriptional repressor

SCOPe Domain Sequences for d1irqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irqb_ a.43.1.4 (B:) Omega transcriptional repressor {Streptococcus pyogenes [TaxId: 1314]}
dimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl

SCOPe Domain Coordinates for d1irqb_:

Click to download the PDB-style file with coordinates for d1irqb_.
(The format of our PDB-style files is described here.)

Timeline for d1irqb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1irqa_