Class a: All alpha proteins [46456] (226 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (3 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (11 proteins) |
Protein Interleukin-2 (IL-2) [47301] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47302] (11 PDB entries) |
Domain d1irl__: 1irl - [16883] mutant |
PDB Entry: 1irl (more details)
SCOP Domain Sequences for d1irl__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1irl__ a.26.1.2 (-) Interleukin-2 (IL-2) {Human (Homo sapiens)} aptssstkktqlqlehllldlqmilnginnyknpkltrmltakfympkkatelkhlqcle eelkpleevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnr witfcqsiistlt
Timeline for d1irl__: