Lineage for d1iq6a_ (1iq6 A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
core: beta-alpha-beta(4); 2 layers: alpha/betaSuperfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) 
Family d.38.1.4: MaoC-like [82636] (6 proteins) 
Protein (R)-specific enoyl-CoA hydratase [82637] (1 species)
involved in polyhydroxyalkanoate (PHA) biosynthesisSpecies Aeromonas caviae [TaxId:648] [82638] (1 PDB entry) 
Domain d1iq6a_: 1iq6 A: [76755]
complexed with ipa
Details for d1iq6a_
PDB Entry: 1iq6 (more details), 1.5 Å
PDB Description: (r)-hydratase from a. caviae involved in pha biosynthesis
PDB Compounds: (A:) (r)-specific enoyl-coa hydrataseSCOPe Domain Sequences for d1iq6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]}
aqslevgqkarlskrfgaaevaafaalsedfnplhldpafaattaferpivhgmllaslf
sgllgqqlpgkgsiylgqslsfklpvfvgdevtaevevtalredkpiatlttriftqgga
lavtgeavvklp
SCOPe Domain Coordinates for d1iq6a_:
Click to download the PDB-style file with coordinates for d1iq6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iq6a_:
- d1iq6a_ first appeared in SCOP 1.63
- d1iq6a_ appears in SCOPe 2.07
View in 3D
