Lineage for d1iowa1 (1iow A:1-96)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
possible rudiment form of Rossmann-fold domainSuperfamily c.30.1: PreATP-grasp domain [52440] (9 families) 
precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
Family c.30.1.2: D-Alanine ligase N-terminal domain [52452] (2 proteins) Protein D-Ala-D-Ala ligase, N-domain [52453] (3 species) Species Escherichia coli, gene ddlB [TaxId:562] [52454] (3 PDB entries) 
Domain d1iowa1: 1iow A:1-96 [31713]
Other proteins in same PDB: d1iowa2
complexed with adp, mg, phy
Details for d1iowa1
PDB Entry: 1iow (more details), 1.9 Å
PDB Description: complex of y216f d-ala:d-ala ligase with adp and a phosphoryl phosphinate
PDB Compounds: (A:) d-ala:d-ala ligaseSCOPe Domain Sequences for d1iowa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iowa1 c.30.1.2 (A:1-96) D-Ala-D-Ala ligase, N-domain {Escherichia coli, gene ddlB [TaxId: 562]}
mtdkiavllggtsaerevslnsgaavlaglreggidaypvdpkevdvtqlksmgfqkvfi
alhgrggedgtlqgmlelmglpytgsgvmasalsmd
SCOPe Domain Coordinates for d1iowa1:
Click to download the PDB-style file with coordinates for d1iowa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iowa1:
- d1iowa1 first appeared (with stable ids) in SCOP 1.55, called d1iow_1
- d1iowa1 appears in SCOPe 2.04
- d1iowa1 appears in SCOPe 2.06
- d1iowa1 appears in the current release, SCOPe 2.08
View in 3D
