Lineage for d1io2a_ (1io2 A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 836757Superfamily c.55.3: Ribonuclease H-like [53098] (14 families) (S)
    consists of one domain of this fold
  5. 836758Family c.55.3.1: Ribonuclease H [53099] (4 proteins)
  6. 836776Protein Class II ribonuclease H (RNase HII) [53103] (5 species)
  7. 836787Species Archaeon Thermococcus kodakaraensis [TaxId:311400] [64094] (2 PDB entries)
  8. 836788Domain d1io2a_: 1io2 A: [62612]

Details for d1io2a_

PDB Entry: 1io2 (more details), 2 Å

PDB Description: Crystal structure of type 2 ribonuclease h from hyperthermophilic archaeon, thermococcus kodakaraensis kod1
PDB Compounds: (A:) ribonuclease hii

SCOP Domain Sequences for d1io2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1io2a_ c.55.3.1 (A:) Class II ribonuclease H (RNase HII) {Archaeon Thermococcus kodakaraensis [TaxId: 311400]}
mkiagideagrgpvigpmviaavvvdenslpkleelkvrdskkltpkrreklfneilgvl
ddyvilelppdvigsregtlnefevenfakalnslkvkpdviyadaadvdeerfarelge
rlnfeaevvakhkaddifpvvsaasilakvtrdraveklkeeygeigsgypsdprtrafl
enyyrehgefppivrkgwktlkkiaekvesekk

SCOP Domain Coordinates for d1io2a_:

Click to download the PDB-style file with coordinates for d1io2a_.
(The format of our PDB-style files is described here.)

Timeline for d1io2a_: