Lineage for d1imja_ (1imj A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901308Family c.69.1.23: Ccg1/TafII250-interacting factor B (Cib) [75285] (1 protein)
  6. 2901309Protein Ccg1/TafII250-interacting factor B (Cib) [75286] (1 species)
  7. 2901310Species Human (Homo sapiens) [TaxId:9606] [75287] (1 PDB entry)
  8. 2901311Domain d1imja_: 1imj A: [71246]
    complexed with so4

Details for d1imja_

PDB Entry: 1imj (more details), 2.2 Å

PDB Description: crystal structure of the human ccg1/tafii250-interacting factor b (cib)
PDB Compounds: (A:) ccg1-interacting factor b

SCOPe Domain Sequences for d1imja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]}
aasveqregtiqvqgqalffrealpgsgqarfsvlllhgirfssetwqnlgtlhrlaqag
yravaidlpglghskeaaapapigelapgsflaavvdalelgppvvispslsgmyslpfl
tapgsqlpgfvpvapictdkinaanyasvktpalivygdqdpmgqtsfehlkqlpnhrvl
imkgaghpcyldkpeewhtglldflqgl

SCOPe Domain Coordinates for d1imja_:

Click to download the PDB-style file with coordinates for d1imja_.
(The format of our PDB-style files is described here.)

Timeline for d1imja_: