![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.23: Ccg1/TafII250-interacting factor B (Cib) [75285] (1 protein) |
![]() | Protein Ccg1/TafII250-interacting factor B (Cib) [75286] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75287] (1 PDB entry) |
![]() | Domain d1imja_: 1imj A: [71246] complexed with so4 |
PDB Entry: 1imj (more details), 2.2 Å
SCOPe Domain Sequences for d1imja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} aasveqregtiqvqgqalffrealpgsgqarfsvlllhgirfssetwqnlgtlhrlaqag yravaidlpglghskeaaapapigelapgsflaavvdalelgppvvispslsgmyslpfl tapgsqlpgfvpvapictdkinaanyasvktpalivygdqdpmgqtsfehlkqlpnhrvl imkgaghpcyldkpeewhtglldflqgl
Timeline for d1imja_: