Lineage for d1ik6a2 (1ik6 A:192-326)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1370884Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 1370885Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 1370937Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (4 proteins)
    automatically mapped to Pfam PF02780
  6. 1370979Protein E1-beta subunit of pyruvate dehydrogenase, C-domain [69521] (2 species)
  7. 1370994Species Pyrobaculum aerophilum [TaxId:13773] [69522] (1 PDB entry)
  8. 1370995Domain d1ik6a2: 1ik6 A:192-326 [66175]
    Other proteins in same PDB: d1ik6a1

Details for d1ik6a2

PDB Entry: 1ik6 (more details), 2 Å

PDB Description: 3D structure of the E1beta subunit of pyruvate dehydrogenase from the archeon Pyrobaculum aerophilum
PDB Compounds: (A:) pyruvate dehydrogenase

SCOPe Domain Sequences for d1ik6a2:

Sequence, based on SEQRES records: (download)

>d1ik6a2 c.48.1.2 (A:192-326) E1-beta subunit of pyruvate dehydrogenase, C-domain {Pyrobaculum aerophilum [TaxId: 13773]}
dyvveigkarvaregddvtlvtygavvhkaleaaervkasvevvdlqtlnpldfdtvlks
vsktgrliiahdspktgglgaevralvaekaldrltapvirlagpdvpqspiaadaayap
tveriikaieyvmry

Sequence, based on observed residues (ATOM records): (download)

>d1ik6a2 c.48.1.2 (A:192-326) E1-beta subunit of pyruvate dehydrogenase, C-domain {Pyrobaculum aerophilum [TaxId: 13773]}
dyvveigkarvaregddvtlvtygavvhkaleaaervkasvevvdlqtlnpldfdtvlks
vsktgrliiahdspktgglgaevralvaekaldrltapvirlagpdvptveriikaieyv
mry

SCOPe Domain Coordinates for d1ik6a2:

Click to download the PDB-style file with coordinates for d1ik6a2.
(The format of our PDB-style files is described here.)

Timeline for d1ik6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ik6a1