Lineage for d1ijza_ (1ijz A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1085916Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1085917Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1085997Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 1086016Protein Interleukin-13 (IL-13) [63532] (1 species)
  7. 1086017Species Human (Homo sapiens) [TaxId:9606] [63533] (7 PDB entries)
  8. 1086024Domain d1ijza_: 1ijz A: [71239]

Details for d1ijza_

PDB Entry: 1ijz (more details)

PDB Description: solution structure of human il-13
PDB Compounds: (A:) interleukin-13

SCOPe Domain Sequences for d1ijza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijza_ a.26.1.2 (A:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]}
mgpvppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsai
ektqrmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregrfn

SCOPe Domain Coordinates for d1ijza_:

Click to download the PDB-style file with coordinates for d1ijza_.
(The format of our PDB-style files is described here.)

Timeline for d1ijza_: