Lineage for d1ijxa_ (1ijx A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734685Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily)
    Core: 3 helices; irregular array; disulfide-rich
  4. 2734686Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families) (S)
    automatically mapped to Pfam PF01392
  5. 2734687Family a.141.1.1: Frizzled cysteine-rich domain [63502] (3 proteins)
  6. 2734701Protein Secreted Frizzled-related protein 3 (SFRP-3;fzb) [63503] (1 species)
  7. 2734702Species Mouse (Mus musculus) [TaxId:10090] [63504] (1 PDB entry)
  8. 2734703Domain d1ijxa_: 1ijx A: [62511]
    CASP4
    complexed with so4

Details for d1ijxa_

PDB Entry: 1ijx (more details), 1.9 Å

PDB Description: crystal structure of the cysteine-rich domain of secreted frizzled- related protein 3 (sfrp-3;fzb)
PDB Compounds: (A:) secreted frizzled-related sequence protein 3

SCOPe Domain Sequences for d1ijxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijxa_ a.141.1.1 (A:) Secreted Frizzled-related protein 3 (SFRP-3;fzb) {Mouse (Mus musculus) [TaxId: 10090]}
aacepvriplckslpwemtkmpnhlhhstqanailameqfegllgthcspdllfflcamy
apictidfqhepikpcksvcerarqgcepilikyrhswpeslacdelpvydrgvcispea
ivtad

SCOPe Domain Coordinates for d1ijxa_:

Click to download the PDB-style file with coordinates for d1ijxa_.
(The format of our PDB-style files is described here.)

Timeline for d1ijxa_: