Lineage for d1ijha2 (1ijh A:319-450)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
alpha+beta sandwichSuperfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) 
N-terminal domain is beta/beta/alpha common foldFamily d.16.1.1: GMC oxidoreductases [54374] (5 proteins) Protein Cholesterol oxidase [54375] (3 species) Species Streptomyces sp. [TaxId:1931] [54377] (14 PDB entries) 
Domain d1ijha2: 1ijh A:319-450 [66162]
Other proteins in same PDB: d1ijha1
complexed with fad; mutant
Details for d1ijha2
PDB Entry: 1ijh (more details), 1.53 Å
PDB Description: cholesterol oxidase from streptomyces asn485leu mutant
PDB Compounds: (A:) cholesterol oxidaseSCOPe Domain Sequences for d1ijha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ijha2 d.16.1.1 (A:319-450) Cholesterol oxidase {Streptomyces sp. [TaxId: 1931]}
gpngnimtaranhmwnptgahqssipalgidawdnsdssvfaeiapmpagletwvslyla
itknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlk
afaddfcyhplg
SCOPe Domain Coordinates for d1ijha2:
Click to download the PDB-style file with coordinates for d1ijha2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ijha2:
- d1ijha2 first appeared in SCOP 1.59
- d1ijha2 appears in SCOPe 2.07
View in 3D
