Lineage for d1ij8b_ (1ij8 B:)
- Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds) 
Fold b.61: Streptavidin-like [50875] (8 superfamilies)
barrel, closed; n=8, S=10; meanderSuperfamily b.61.1: Avidin/streptavidin [50876] (2 families) 
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) 
Protein Avidin [50880] (1 species) Species Chicken (Gallus gallus) [TaxId:9031] [50881] (10 PDB entries) 
Domain d1ij8b_: 1ij8 B: [62481]
complexed with bni, ndg
Details for d1ij8b_
PDB Entry: 1ij8 (more details), 2 Å
PDB Description: crystal structure of lite avidin-bni complex
PDB Compounds: (B:) AvidinSCOPe Domain Sequences for d1ij8b_:
Sequence, based on SEQRES records: (download)
>d1ij8b_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtq
ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
rl
Sequence, based on observed residues (ATOM records): (download)
>d1ij8b_ b.61.1.1 (B:) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtneikesplhgtentinkrtqptf
gftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftrl
SCOPe Domain Coordinates for d1ij8b_:
Click to download the PDB-style file with coordinates for d1ij8b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ij8b_:
- d1ij8b_ first appeared in SCOP 1.57
- d1ij8b_ appears in SCOPe 2.01
- d1ij8b_ appears in SCOPe 2.03
- d1ij8b_ appears in the current release, SCOPe 2.08
View in 3D
