Lineage for d1ihoa_ (1iho A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1160658Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1160659Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1161063Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins)
    contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
  6. 1161064Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (5 species)
  7. 1161065Species Escherichia coli [TaxId:562] [63978] (1 PDB entry)
  8. 1161066Domain d1ihoa_: 1iho A: [62390]
    complexed with edo, trs

Details for d1ihoa_

PDB Entry: 1iho (more details), 1.7 Å

PDB Description: crystal apo-structure of pantothenate synthetase from e. coli
PDB Compounds: (A:) Pantoate--beta-alanine ligase

SCOPe Domain Sequences for d1ihoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ihoa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Escherichia coli [TaxId: 562]}
mliietlpllrqqirrlrmegkrvalvptmgnlhdghmklvdeakaradvvvvsifvnpm
qfdrpedlaryprtlqedceklnkrkvdlvfapsvkeiypngtethtyvdvpglstmleg
asrpghfrgvstivsklfnlvqpdiacfgekdfqqlalirkmvadmgfdieivgvpimra
kdglalssrngyltaeqrkiapglykvlssiadklqagerdldeiitiagqelnekgfra
ddiqirdadtllevsetskravilvaawlgdarlidnkmvel

SCOPe Domain Coordinates for d1ihoa_:

Click to download the PDB-style file with coordinates for d1ihoa_.
(The format of our PDB-style files is described here.)

Timeline for d1ihoa_: