Class b: All beta proteins [48724] (178 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.3: Caliciviridae-like VP [88637] (2 proteins) |
Protein Calicivirus capsid protein [63691] (1 species) includes the P (protruding) domain of complex beta-structure containing a beta-barrel similar to the second domain of EF-TU |
Species Norwalk virus [TaxId:11983] [63692] (1 PDB entry) |
Domain d1ihmb_: 1ihm B: [62386] |
PDB Entry: 1ihm (more details), 3.4 Å
SCOPe Domain Sequences for d1ihmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihmb_ b.121.4.3 (B:) Calicivirus capsid protein {Norwalk virus [TaxId: 11983]} ssvdgasgagqlvpevnasdplamdpvagsstavatagqvnpidpwiinnfvqapqgeft ispnntpgdvlfdlslgphlnpfllhlsqmyngwvgnmrvrimlagnaftagkiivscip pgfgshnltiaqatlfphviadvrtldpievpledvrnvlfhnndrnqqtmrlvcmlytp lrtgggtgdsfvvagrvmtcpspdfnflflvpptveqktrpftlpnlplsslsnsraplp issmgispdnvqsvqfqngrctldgrlvgttpvslshvakirgtsngtvinlteldgtpf hpfegpapigfpdlggcdwhinmtqfghssqtqydvdttpdtfvphlgsiqangigsgny vgvlswisppshpsgsqvdlwkipnygssiteathlapsvyppgfgevlvffmskmpgpg aynlpcllpqeyishlaseqaptvgeaallhyvdpdtgrnlgefkaypdgfltcvpngas sgpqqlpingvfvfvswvsrfyqlkpvgtas
Timeline for d1ihmb_: