![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
![]() | Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) ![]() dimer of identical subunits |
![]() | Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins) |
![]() | Protein Integration host factor alpha subunit (IHFA) [88878] (1 species) heterodimer of two related subunits |
![]() | Species Escherichia coli [TaxId:562] [88879] (4 PDB entries) |
![]() | Domain d1ihfa_: 1ihf A: [17893] Other proteins in same PDB: d1ihfb_ protein/DNA complex; complexed with cd |
PDB Entry: 1ihf (more details), 2.5 Å
SCOPe Domain Sequences for d1ihfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihfa_ a.55.1.1 (A:) Integration host factor alpha subunit (IHFA) {Escherichia coli [TaxId: 562]} altkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqrp grnpktgedipitarrvvtfrpgqklksrvenaspk
Timeline for d1ihfa_: