Lineage for d1igtb3 (1igt B:236-361)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1761466Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 1761549Species Mouse (Mus musculus), gamma2 [TaxId:10090] [88587] (1 PDB entry)
  8. 1761550Domain d1igtb3: 1igt B:236-361 [20868]
    Other proteins in same PDB: d1igta1, d1igta2, d1igtb1, d1igtb2, d1igtb4, d1igtc1, d1igtc2, d1igtd1, d1igtd2, d1igtd4
    part of intact IgG2a antibody Mab231

Details for d1igtb3

PDB Entry: 1igt (more details), 2.8 Å

PDB Description: structure of immunoglobulin
PDB Compounds: (B:) igg2a intact antibody - mab231

SCOPe Domain Sequences for d1igtb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igtb3 b.1.1.2 (B:236-361) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]}
pcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnv
evhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkg

SCOPe Domain Coordinates for d1igtb3:

Click to download the PDB-style file with coordinates for d1igtb3.
(The format of our PDB-style files is described here.)

Timeline for d1igtb3: