| Class b: All beta proteins [48724] (174 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) ![]() the N-terminal domains of these repressors bind DNA |
| Family b.34.1.3: Transcriptional repressor protein KorB [69242] (1 protein) |
| Protein Transcriptional repressor protein KorB [69243] (1 species) |
| Species Escherichia coli [TaxId:562] [69244] (2 PDB entries) |
| Domain d1igqa_: 1igq A: [66130] |
PDB Entry: 1igq (more details), 1.7 Å
SCOP Domain Sequences for d1igqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igqa_ b.34.1.3 (A:) Transcriptional repressor protein KorB {Escherichia coli [TaxId: 562]}
kkaivqvehderparlilnrrppaegyawlkyeddgqefeanladvklvalieg
Timeline for d1igqa_: