Lineage for d1igqa_ (1igq A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796061Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) (S)
    the N-terminal domains of these repressors bind DNA
  5. 796142Family b.34.1.3: Transcriptional repressor protein KorB [69242] (1 protein)
  6. 796143Protein Transcriptional repressor protein KorB [69243] (1 species)
  7. 796144Species Escherichia coli [TaxId:562] [69244] (2 PDB entries)
  8. 796145Domain d1igqa_: 1igq A: [66130]

Details for d1igqa_

PDB Entry: 1igq (more details), 1.7 Å

PDB Description: c-terminal domain of transcriptional repressor protein korb
PDB Compounds: (A:) Transcriptional repressor protein KorB

SCOP Domain Sequences for d1igqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igqa_ b.34.1.3 (A:) Transcriptional repressor protein KorB {Escherichia coli [TaxId: 562]}
kkaivqvehderparlilnrrppaegyawlkyeddgqefeanladvklvalieg

SCOP Domain Coordinates for d1igqa_:

Click to download the PDB-style file with coordinates for d1igqa_.
(The format of our PDB-style files is described here.)

Timeline for d1igqa_: