Lineage for d1igoa_ (1igo A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780100Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2780165Species Bacillus subtilis, B230 [TaxId:1423] [74910] (1 PDB entry)
  8. 2780166Domain d1igoa_: 1igo A: [71209]
    complexed with so4

Details for d1igoa_

PDB Entry: 1igo (more details), 2.2 Å

PDB Description: Family 11 xylanase
PDB Compounds: (A:) family 11 xylanase

SCOPe Domain Sequences for d1igoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igoa_ b.29.1.11 (A:) Xylanase II {Bacillus subtilis, B230 [TaxId: 1423]}
attitsnqtgthdgydyelwkdsgntsmtlnsggafsaqwsnignalfrkgkkfdstkth
sqlgnisinynatfnpggnsylcvygwtkdplteyyivdnwgtyrptgtpkgtftvdggt
ydiyettrinqpsiigiatfkqywsvrqtkrtsgtvsvsehfkkweslgmpmgkmyetal
tvegyqsngsanvtanvltiggkpl

SCOPe Domain Coordinates for d1igoa_:

Click to download the PDB-style file with coordinates for d1igoa_.
(The format of our PDB-style files is described here.)

Timeline for d1igoa_: