Lineage for d1igna1 (1ign A:360-445)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1720802Family a.4.1.6: DNA-binding domain of rap1 [46753] (2 proteins)
    duplication: consist of two domains of this fold
  6. 1720803Protein DNA-binding domain of rap1 [46754] (1 species)
  7. 1720804Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46755] (1 PDB entry)
  8. 1720805Domain d1igna1: 1ign A:360-445 [16048]
    protein/DNA complex

Details for d1igna1

PDB Entry: 1ign (more details), 2.25 Å

PDB Description: dna-binding domain of rap1 in complex with telomeric dna site
PDB Compounds: (A:) protein (rap1)

SCOPe Domain Sequences for d1igna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kasftdeedefildvvrknptrrtthtlydeishyvpnhtgnsirhrfrvylskrleyvy
evdkfgklvrdddgnliktkvlppsi

SCOPe Domain Coordinates for d1igna1:

Click to download the PDB-style file with coordinates for d1igna1.
(The format of our PDB-style files is described here.)

Timeline for d1igna1:

1720805
d1igna1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1igna2