Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.6: DNA-binding domain of rap1 [46753] (2 proteins) duplication: consist of two domains of this fold |
Protein DNA-binding domain of rap1 [46754] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46755] (1 PDB entry) |
Domain d1igna1: 1ign A:360-445 [16048] protein/DNA complex |
PDB Entry: 1ign (more details), 2.25 Å
SCOPe Domain Sequences for d1igna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kasftdeedefildvvrknptrrtthtlydeishyvpnhtgnsirhrfrvylskrleyvy evdkfgklvrdddgnliktkvlppsi
Timeline for d1igna1: