Lineage for d1ig8a2 (1ig8 A:225-486)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1857983Family c.55.1.3: Hexokinase [53083] (3 proteins)
  6. 1857998Protein Hexokinase [53084] (2 species)
  7. 1857999Species Baker's yeast (Saccharomyces cerevisiae), pII [TaxId:4932] [64092] (1 PDB entry)
  8. 1858001Domain d1ig8a2: 1ig8 A:225-486 [64747]
    complexed with so4

Details for d1ig8a2

PDB Entry: 1ig8 (more details), 2.2 Å

PDB Description: Crystal Structure of Yeast Hexokinase PII with the correct amino acid sequence
PDB Compounds: (A:) hexokinase PII

SCOPe Domain Sequences for d1ig8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ig8a2 c.55.1.3 (A:225-486) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII [TaxId: 4932]}
etkmgvifgtgvngayydvcsdieklqgklsddippsapmainceygsfdnehvvlprtk
yditideesprpgqqtfekmssgyylgeilrlalmdmykqgfifknqdlskfdkpfvmdt
syparieedpfenledtddlfqnefginttvqerklirrlseligaraarlsvcgiaaic
qkrgyktghiaadgsvynrypgfkekaanalkdiygwtqtslddypikivpaedgsgaga
aviaalaqkriaegksvgiiga

SCOPe Domain Coordinates for d1ig8a2:

Click to download the PDB-style file with coordinates for d1ig8a2.
(The format of our PDB-style files is described here.)

Timeline for d1ig8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ig8a1