Lineage for d1ig6a_ (1ig6 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478502Superfamily a.4.3: ARID-like [46774] (2 families) (S)
    contains extra helices at both N- and C-termini
  5. 1478503Family a.4.3.1: ARID domain [46775] (5 proteins)
  6. 1478508Protein MRF-2 DNA-binding domain [46779] (1 species)
  7. 1478509Species Human (Homo sapiens) [TaxId:9606] [46780] (2 PDB entries)
  8. 1478510Domain d1ig6a_: 1ig6 A: [62364]

Details for d1ig6a_

PDB Entry: 1ig6 (more details)

PDB Description: human mrf-2 domain, nmr, 11 structures
PDB Compounds: (A:) modulator recognition factor 2

SCOPe Domain Sequences for d1ig6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ig6a_ a.4.3.1 (A:) MRF-2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
radeqaflvalykymkerktpieripylgfkqinlwtmfqaaqklggyetitarrqwkhi
ydelggnpgstsaatctrrhyerlilpyerfikgeedkplppikprk

SCOPe Domain Coordinates for d1ig6a_:

Click to download the PDB-style file with coordinates for d1ig6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ig6a_: