Lineage for d1ig1a_ (1ig1 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1930227Protein Death-associated protein kinase, Dap [75560] (1 species)
    CaMK group; CAMKI subfamily; serine/threonine kinase
  7. 1930228Species Human (Homo sapiens) [TaxId:9606] [75561] (20 PDB entries)
    Uniprot P53355 2-285
  8. 1930233Domain d1ig1a_: 1ig1 A: [71208]
    complexed with anp, mn

Details for d1ig1a_

PDB Entry: 1ig1 (more details), 1.8 Å

PDB Description: 1.8A X-Ray structure of ternary complex of a catalytic domain of death-associated protein kinase with ATP analogue and Mn.
PDB Compounds: (A:) death-associated protein kinase

SCOPe Domain Sequences for d1ig1a_:

Sequence, based on SEQRES records: (download)

>d1ig1a_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]}
tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
sntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalssawshpqfe

Sequence, based on observed residues (ATOM records): (download)

>d1ig1a_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]}
tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
sntsalakdfirrllvkdpkkrmtiqdslqhpwikppqfe

SCOPe Domain Coordinates for d1ig1a_:

Click to download the PDB-style file with coordinates for d1ig1a_.
(The format of our PDB-style files is described here.)

Timeline for d1ig1a_: